PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca56092.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 329aa    MW: 37739.4 Da    PI: 5.0356
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca56092.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.51e-5661331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtdeelv +yL +k++g+k+el e+i+e+d+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v+s ++
  Dca56092.1   6 LPPGFRFHPTDEELVAYYLDRKITGRKIEL-EIIPEIDLYKCEPWDLPdKsYLPGKDMEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRPVHS-QK 102
                 79****************************.99**************95335556888**************************************.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + vg+kktLv+ykgrap+g +t+Wvmheyrl
  Dca56092.1 103 RPVGMKKTLVYYKGRAPHGLRTNWVMHEYRL 133
                 9****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-664156IPR003441NAC domain
PROSITE profilePS5100561.3676156IPR003441NAC domain
PfamPF023657.7E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLDRKITG RKIELEIIPE IDLYKCEPWD LPDKSYLPGK  60
DMEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRPVHS QKRPVGMKKT LVYYKGRAPH  120
GLRTNWVMHE YRLLESPPGS TPSLKESYAL CRVFKKTIQI TPRIREDTRE SIDDTSREME  180
VNNEDNVENC YGQNGLSNKF PSETSSELTN QEITPTGSAL SNDHDLQTPI FTTDEANSSS  240
NFYPFGFECP SNFIQDMQMA SNYFNLPPLG IEDFPQINIS GTTIFKPIDH QDTIGCDKFK  300
EYMKGSVMFE DIFDLCSTQG NSIPLPLED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-58115615168NAC domain-containing protein 19
3swm_B7e-58115615168NAC domain-containing protein 19
3swm_C7e-58115615168NAC domain-containing protein 19
3swm_D7e-58115615168NAC domain-containing protein 19
3swp_A7e-58115615168NAC domain-containing protein 19
3swp_B7e-58115615168NAC domain-containing protein 19
3swp_C7e-58115615168NAC domain-containing protein 19
3swp_D7e-58115615168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690417.10.0PREDICTED: NAC domain-containing protein 86-like
SwissprotQ9FFI57e-86NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0J8EEN80.0A0A0J8EEN8_BETVU; Uncharacterized protein
STRINGGLYMA15G41825.11e-133(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.15e-98NAC domain containing protein 20